PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10028255m
Common NameEUTSA_v10028255mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 245aa    MW: 28495.5 Da    PI: 8.1571
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10028255mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.12.6e-191762449
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     e  sn qvtfskR+ g +KKA+EL++LC++e  v++fs++ k++ +
  Thhalv10028255m 17 EKASNLQVTFSKRKYGFFKKASELCTLCGVEMGVVVFSPSRKMFYF 62
                     67899************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-24665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.516666IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-23780IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-14828IPR002100Transcription factor, MADS-box
PfamPF003195.0E-211562IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-142843IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-144364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MARVYRGRRK LPMVKMEKAS NLQVTFSKRK YGFFKKASEL CTLCGVEMGV VVFSPSRKMF  60
YFGNPDIKSV INRFENYLHG PYMCFEDGPN TTIQDLNSQL TQELAKLKVE KERKKFLDKI  120
RNKREEIEKW WENPPNQLDL PQTTCLISVL ENLRMELETQ PSQPSQAIVP QNCYGGSYNN  180
IVGGGNIDLF DQGRMFDVNA LNYDPNMVIP NYGPMFGYSD NYNVFDVFDP RYNMNWPEYN  240
QSQY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405949.10.0hypothetical protein EUTSA_v10028255mg
TrEMBLV4LXZ70.0V4LXZ7_EUTSA; Uncharacterized protein
STRINGBra011938.1-P1e-112(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16574611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-66AGAMOUS-like 62